Sku |
AAP52475 |
Old sku |
AAPP42935 |
Price |
$99.00 |
Name |
LRG1 Peptide - N-terminal region (AAP52475) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
LRG1 |
Alias symbols |
HMFT1766, LRG |
Gene id |
116844 |
Description of target |
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]). |
Swissprot id |
P02750 |
Protein accession num |
NP_443204 |
Nucleotide accession num |
NM_052972 |
Protein size |
347 amino acids |
Molecular weight |
38kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP |
Partner proteins |
FN1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-LRG1 Antibody(ARP52475_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |