| Sku |
AAP52329 |
| Old sku |
AAPP42835 |
| Price |
$99.00 |
| Name |
DNM1L Peptide - N-terminal region (AAP52329) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
DNM1L |
| Alias symbols |
DLP1, DRP1, DVLP, DYMPLE, HDYNIV, VPS1, EMPF, DYNIV-11 |
| Gene id |
10059 |
| Description of target |
The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated. |
| Swissprot id |
O00429 |
| Protein accession num |
NP_036192 |
| Nucleotide accession num |
NM_012062 |
| Protein size |
736 amino acids |
| Molecular weight |
82kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG |
| Partner proteins |
FIS1,GSK3B,MAP3K10,SIRT3,VIM,FIS1,GSK3B,PEX11A,PEX11B,PEX11E,PEX11G,PEX25,RGAG4,UBC |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-DNM1L Antibody(ARP52329_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
