CHP Peptide - N-terminal region (AAP52307)

Data Sheet
 
Sku AAP52307
Old sku AAPP43725
Price $99.00
Name CHP Peptide - N-terminal region (AAP52307)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CHP1
Alias symbols SLC9A1BP, CHP
Gene id 11261
Description of target This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
Swissprot id Q99653
Protein accession num NP_009167
Nucleotide accession num NM_007236
Protein size 195 amino acids
Molecular weight 22kDa
Species reactivity Human
Application IHC, WB
Peptide sequence FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM
Partner proteins vpu; UBC; ELAVL1; SLC9A4; PRSS23; KIF1B; STK17B; SLC9A2; SLC9A5; SLC9A3; GAPDH; SLC9A1;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CHP Antibody(ARP52307_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com