| Sku |
AAP52225 |
| Old sku |
AAPP42435 |
| Price |
$99.00 |
| Name |
CPLX2 Peptide - N-terminal region (AAP52225) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CPLX2 |
| Alias symbols |
921-L, CPX-2, CPX2, Hfb1, MGC138492 |
| Gene id |
10814 |
| Description of target |
Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. |
| Swissprot id |
Q6PUV4 |
| Protein accession num |
NP_006641 |
| Nucleotide accession num |
NM_006650 |
| Protein size |
134 amino acids |
| Molecular weight |
15kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA |
| Partner proteins |
STX2,STX3,STX1A |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CPLX2 Antibody(ARP52225_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
