Csnk1a1 Peptide - N-terminal region (AAP51842)

Data Sheet
 
Sku AAP51842
Price $99.00
Name Csnk1a1 Peptide - N-terminal region (AAP51842)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Csnk1a1
Alias symbols MGC156603
Gene id 113927
Description of target Splice variant isoforms CKI alpha and CKI alpha L both have casein kinase I activity but display differences in substrate kinetics.
Swissprot id P97633
Protein accession num NP_446067
Nucleotide accession num NM_053615
Protein size 325 amino acids
Molecular weight 35kDa
Species reactivity Rat, Human
Application WB
Peptide sequence FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Csnk1a1 Antibody (ARP51842_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com