| Sku |
AAP51757 |
| Old sku |
AAPP40132 |
| Price |
$99.00 |
| Name |
ADA Peptide - N-terminal region (AAP51757) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ADA |
| Gene id |
100 |
| Description of target |
ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia. |
| Swissprot id |
P00813 |
| Protein accession num |
NP_000013 |
| Nucleotide accession num |
NM_000022 |
| Protein size |
363 amino acids |
| Molecular weight |
41kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA |
| Partner proteins |
ADORA1,ADORA2A,ADORA2B,DPP4,DRD1,GRB2,NR3C1,ADORA1,ADORA2A,DRD1,NR3C1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ADA Antibody(ARP51757_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
