| Sku |
AAP51316 |
| Old sku |
AAPP46572 |
| Price |
$99.00 |
| Name |
NTRK2 Peptide - C-terminal region (AAP51316) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NTRK2 |
| Alias symbols |
GP145-TrkB, TRKB, trk-B |
| Gene id |
4915 |
| Description of target |
This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. |
| Swissprot id |
Q8WXJ5 |
| Protein accession num |
NP_001018075 |
| Nucleotide accession num |
NM_001018065 |
| Protein size |
553 amino acids |
| Molecular weight |
57kDa |
| Species reactivity |
Human |
| Application |
IF, WB, IHC |
| Peptide sequence |
DFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPD |
| Partner proteins |
NTF4,NTF4,NTF4,NTF4,BDNF,DOK5,DYNLL1,FRS3,FYN,GIPC1,KIDINS220,NCK1,NCK2,NGFR,NTF3,NTF4,NTRK2,PLCG1,PTPN1,PTPN11,RASGRF1,SH2B1,SH2B2,SHC1,SHC2,SHC3,SQSTM1,UBB,BDNF,DYNLL1,FRS2,FYN,GIPC1,NCK2,NTF3,NTF4,PIK3R1,PLCG1,PTPN1,SH2B1,SHC1,SHC3,SQSTM1,TRAF6,UBC |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NTRK2 Antibody (ARP51316_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
