| Sku |
AAP51279 |
| Old sku |
AAPS22306 |
| Price |
$99.00 |
| Name |
FZR1 Peptide - N-terminal region (AAP51279) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
FZR1 |
| Alias symbols |
CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242 |
| Gene id |
51343 |
| Description of target |
FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis. |
| Swissprot id |
Q9UM11 |
| Protein accession num |
NP_057347 |
| Nucleotide accession num |
NM_016263 |
| Protein size |
493 amino acids |
| Molecular weight |
55kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN |
| Partner proteins |
CCNB1,CDC27,NEDD9,ANAPC2,C7orf25,CCNB1,CDC14A,CDC27,CDK2,DNAJA1,FBXO5,SKIL,SKP2,SKP2,ANAPC1,ANAPC2,ANAPC4,ANAPC5,ANAPC7,CDC14A,CDC20,CDC27,CDT1,FBXO5,MAD2L2,SKIL,TPX2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-FZR1 Antibody(ARP51279_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
