Sku |
AAP51005 |
Price |
$99 |
Name |
NOTO Peptide - C-terminal region (AAP51005) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
NOTO |
Alias symbols |
NOTO, |
Gene id |
344022 |
Description of target |
NOTO is a transcription regulator acting downstream of both FOXA2 and T during notochord development. It is required for node morphogenesis. It is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; it acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. And it plays a role in regulating axial versus paraxial cell fate (By similarity). |
Swissprot id |
A8MTQ0 |
Protein accession num |
NP_001127934 |
Protein size |
251 amino acids |
Molecular weight |
27kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-NOTO Antibody (ARP51005_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |