MED25 Peptide - N-terminal region (AAP50698)

Data Sheet
 
Sku AAP50698
Old sku AAPP44777
Price $99.00
Name MED25 Peptide - N-terminal region (AAP50698)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MED25
Alias symbols ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758
Gene id 81857
Description of target This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Swissprot id Q71SY5
Protein accession num NP_112235
Nucleotide accession num NM_030973
Protein size 747 amino acids
Molecular weight 78kDa
Species reactivity Human
Application WB, CHIP
Peptide sequence EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
Partner proteins CDK8,HCFC1,MED1,MED15,MED6,MED8,MED9,TFF1,CDK8,MED1,MED10,MED11,MED15,MED17,MED18,MED19,MED22,MED26,MED28,MED29,MED4,MED6,MED8,MED9,UL48
Subunit 25
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MED25 Antibody(ARP50698_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com