Sku |
AAP50698 |
Old sku |
AAPP44777 |
Price |
$99.00 |
Name |
MED25 Peptide - N-terminal region (AAP50698) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
MED25 |
Alias symbols |
ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758 |
Gene id |
81857 |
Description of target |
This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2. |
Swissprot id |
Q71SY5 |
Protein accession num |
NP_112235 |
Nucleotide accession num |
NM_030973 |
Protein size |
747 amino acids |
Molecular weight |
78kDa |
Species reactivity |
Human |
Application |
WB, CHIP |
Peptide sequence |
EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV |
Partner proteins |
CDK8,HCFC1,MED1,MED15,MED6,MED8,MED9,TFF1,CDK8,MED1,MED10,MED11,MED15,MED17,MED18,MED19,MED22,MED26,MED28,MED29,MED4,MED6,MED8,MED9,UL48 |
Subunit |
25 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-MED25 Antibody(ARP50698_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |