| Sku |
AAP50614 |
| Price |
99 |
| Name |
PTOV1 Peptide - N-terminal region (AAP50614) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
PTOV1 |
| Alias symbols |
PTOV1,ACID2,PP642, UNQ6127/PRO20092, |
| Gene id |
53635 |
| Description of target |
PTOV1 may activate transcription. It is required for nuclear translocation of FLOT1. And it promotes cell proliferation. |
| Swissprot id |
Q86YD1 |
| Protein accession num |
XP_005259057 |
| Protein size |
416 amino acids |
| Molecular weight |
45kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: LPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFT |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-PTOV1 Antibody (ARP50614_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
