ATXN3 Peptide - N-terminal region (AAP50507)

Data Sheet
 
Sku AAP50507
Old sku AAPP44281
Price $99.00
Name ATXN3 Peptide - N-terminal region (AAP50507)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ATXN3
Alias symbols AT3, ATX3, JOS, MJD, MJD1, SCA3
Gene id 4287
Description of target Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Swissprot id P54252
Protein accession num NP_004984
Nucleotide accession num NM_004993
Protein size 361 amino acids
Molecular weight 41kDa
Species reactivity Human
Application WB
Peptide sequence SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL
Partner proteins CASP1,CASP3,ARHGAP19,C16orf70,CASP1,EWSR1,PICK1,PSMD7,RAD23A,RAD23B,TEX11,UBB,UBQLN1,VCP,HDAC3,KCTD10,NCOR1,OTUB2,PRE1,RAD23A,RAD23A,RAD23B,RAD23B,SUP35,UBC,USP13,VCP
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ATXN3 Antibody(ARP50507_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com