Sku |
AAP50507 |
Old sku |
AAPP44281 |
Price |
$99.00 |
Name |
ATXN3 Peptide - N-terminal region (AAP50507) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
ATXN3 |
Alias symbols |
AT3, ATX3, JOS, MJD, MJD1, SCA3 |
Gene id |
4287 |
Description of target |
Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Swissprot id |
P54252 |
Protein accession num |
NP_004984 |
Nucleotide accession num |
NM_004993 |
Protein size |
361 amino acids |
Molecular weight |
41kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL |
Partner proteins |
CASP1,CASP3,ARHGAP19,C16orf70,CASP1,EWSR1,PICK1,PSMD7,RAD23A,RAD23B,TEX11,UBB,UBQLN1,VCP,HDAC3,KCTD10,NCOR1,OTUB2,PRE1,RAD23A,RAD23A,RAD23B,RAD23B,SUP35,UBC,USP13,VCP |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-ATXN3 Antibody(ARP50507_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |