Sku |
AAP50098 |
Old sku |
AAPP44760 |
Price |
$99.00 |
Name |
USP30 Peptide - middle region (AAP50098) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
USP30 |
Alias symbols |
FLJ40511, MGC10702 |
Gene id |
84749 |
Description of target |
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]). |
Swissprot id |
Q70CQ3 |
Protein accession num |
NP_116052 |
Nucleotide accession num |
NM_032663 |
Protein size |
508 amino acids |
Molecular weight |
57kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH |
Partner proteins |
CLPB,MPND,QKI,SF3A1,SS18L1,TIMM8A |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-USP30 Antibody(ARP50098_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |