| Sku |
AAP49984 |
| Old sku |
AAPP44260 |
| Price |
$99.00 |
| Name |
SPACA1 Peptide - N-terminal region (AAP49984) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SPACA1 |
| Alias symbols |
MGC32952, SAMP32 |
| Gene id |
81833 |
| Description of target |
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively. |
| Swissprot id |
Q9HBV2 |
| Protein accession num |
NP_112222 |
| Nucleotide accession num |
NM_030960 |
| Protein size |
294 amino acids |
| Molecular weight |
32kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SPACA1 Antibody(ARP49984_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
