| Sku |
AAP49763 |
| Old sku |
AAPP29340 |
| Price |
$99.00 |
| Name |
Porcn Peptide - middle region (AAP49763) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Porcn |
| Alias symbols |
2410004O13Rik, AW045557, DXHXS7465e, Mporc, Mporc-a, Mporc-b, Mporc-c, Mporc-d, Ppn, mMg61, porc |
| Gene id |
53627 |
| Description of target |
Porcn modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members. |
| Swissprot id |
Q9JJJ7-4 |
| Protein accession num |
NP_058609 |
| Nucleotide accession num |
NM_016913 |
| Protein size |
450 amino acids |
| Molecular weight |
51kDa |
| Species reactivity |
Mouse |
| Application |
WB |
| Peptide sequence |
VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA |
| Partner proteins |
Wnt1,Wnt3,Wnt3a,Wnt4,Wnt5a,Wnt5b,Wnt6,Wnt7a,Wnt7b,Wnt1,Wnt3,Wnt3a,Wnt4,Wnt5a,Wnt5b,Wnt6,Wnt7a,Wnt7b |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Porcn Antibody (ARP49763_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
