EIF4A1 Peptide - middle region (AAP48065)

Data Sheet
 
Sku AAP48065
Old sku AAPS21108
Price $99.00
Name EIF4A1 Peptide - middle region (AAP48065)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene EIF4A1
Alias symbols DDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I
Gene id 1973
Description of target EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Swissprot id P60842
Protein accession num NP_001407
Nucleotide accession num NM_001416
Protein size 406 amino acids
Molecular weight 46kDa
Species reactivity Human
Application WB
Peptide sequence TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
Partner proteins EIF4G1,EIF4G2,EIF4G3,LPPR4,PAIP1,UPF2,EIF3A,EIF3B,EIF4E,EIF4G1,EIF4G2,EIF4G3,MEPCE,PABPC1,PAIP1,PDCD4,RPAP3,UPF2
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-EIF4A1 Antibody(ARP48065_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com