Sku |
AAP48065 |
Old sku |
AAPS21108 |
Price |
$99.00 |
Name |
EIF4A1 Peptide - middle region (AAP48065) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
EIF4A1 |
Alias symbols |
DDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I |
Gene id |
1973 |
Description of target |
EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon. |
Swissprot id |
P60842 |
Protein accession num |
NP_001407 |
Nucleotide accession num |
NM_001416 |
Protein size |
406 amino acids |
Molecular weight |
46kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC |
Partner proteins |
EIF4G1,EIF4G2,EIF4G3,LPPR4,PAIP1,UPF2,EIF3A,EIF3B,EIF4E,EIF4G1,EIF4G2,EIF4G3,MEPCE,PABPC1,PAIP1,PDCD4,RPAP3,UPF2 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-EIF4A1 Antibody(ARP48065_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |