| Sku |
AAP47592 |
| Old sku |
AAPP28452 |
| Price |
$99.00 |
| Name |
SMC3 Peptide - N-terminal region (AAP47592) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SMC3 |
| Alias symbols |
BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1 |
| Gene id |
9126 |
| Description of target |
SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. |
| Swissprot id |
Q9UQE7 |
| Protein accession num |
NP_005436 |
| Nucleotide accession num |
NM_005445 |
| Protein size |
1217 amino acids |
| Molecular weight |
141kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
KWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDAR |
| Partner proteins |
FEZ1,KIFAP3,MXD1,MXI1,RPGR,SMC1A,SMC1B,AIRE,APC,ATM,BECN1,CAMKK2,CASP4,CDCA5,CDK4,FEZ1,FEZ2,HDAC2,KIFAP3,MAGED1,MXD1,MXD3,MXD4,MXI1,NEK6,NUMA1,PDS5A,PMS1,RAE1,REC8,RPGR,SMARCA5,SMC1A,SRRM1,STAG1,STAG3,SYCP3,TUBB,USP13,WFDC5,tat |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SMC3 Antibody(ARP47592_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
