| Sku |
AAP46583 |
| Old sku |
AAPS19506 |
| Price |
$99.00 |
| Name |
DCC Peptide - middle region (AAP46583) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
DCC |
| Alias symbols |
CRC18, CRCR1, IGDCC1 |
| Gene id |
1630 |
| Description of target |
This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma. |
| Swissprot id |
P43146 |
| Protein accession num |
NP_005206 |
| Nucleotide accession num |
NM_005215 |
| Protein size |
1447 amino acids |
| Molecular weight |
158kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ |
| Partner proteins |
FYN,PTK2,PTK2,SIAH1,SIAH1,SIAH2,SIAH2,ADORA2B,APPL1,CASP3,CASP9,MAPK3,MAZ,NCK1,NTN1,PITPNA,PTK2,SIAH1,SIAH2,APPL1,AR,CASP3,CASP9,MAPK3,MAZ,NCK1,NTN1,PTK2,PTK2B,SIAH1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-DCC Antibody(ARP46583_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
