| Sku |
AAP46096 |
| Price |
$99.00 |
| Name |
FEN1 Peptide - N-terminal region (AAP46096) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
FEN1 |
| Alias symbols |
FEN-1, MF1, RAD2 |
| Gene id |
2237 |
| Description of target |
FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions. |
| Swissprot id |
P39748 |
| Protein accession num |
NP_004102 |
| Nucleotide accession num |
NM_004111 |
| Protein size |
380 amino acids |
| Molecular weight |
42kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH |
| Partner proteins |
PCNA,PCNA,PCNA,APEX1,ARHGDIA,BLM,CDK1,CDK2,EEF1G,EP300,HNRNPA1,PCNA,RAD1,WRN,APEX1,ARHGDIA,BLM,CCNA2,CDK1,CDK2,DDX11,EEF1G,ENDOG,EP300,HNRNPA1,HUS1,NCAPG,PCNA,RAD1,RAD9A,WRN |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-FEN1 Antibody (ARP46096_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
