| Sku |
AAP45676 |
| Old sku |
AAPP26688 |
| Price |
$99.00 |
| Name |
MBL2 Peptide - middle region (AAP45676) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MBL2 |
| Alias symbols |
COLEC1, HSMBPC, MBL, MBP, MBP1, MGC116832, MGC116833, MBL2D, MBP-C |
| Gene id |
4153 |
| Description of target |
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. |
| Swissprot id |
Q66S64 |
| Protein accession num |
NP_000233 |
| Nucleotide accession num |
NM_000242 |
| Protein size |
248 amino acids |
| Molecular weight |
24kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN |
| Partner proteins |
CALCR,CALR,CD93,KRT1,MAD2L1,MASP1,MASP2,MBL2,PTPRC,CALR,KRT1,MASP1,MASP2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MBL2 Antibody(ARP45676_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
