| Sku |
AAP45473 |
| Old sku |
AAPP26538 |
| Price |
$99.00 |
| Name |
SCG2 Peptide - N-terminal region (AAP45473) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SCG2 |
| Alias symbols |
CHGC, SN, SgII |
| Gene id |
7857 |
| Description of target |
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. |
| Swissprot id |
P13521 |
| Protein accession num |
NP_003460 |
| Nucleotide accession num |
NM_003469 |
| Protein size |
617 amino acids |
| Molecular weight |
71kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ |
| Partner proteins |
UBQLN4 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SCG2 Antibody(ARP45473_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
