| Sku |
AAP45446 |
| Old sku |
AAPP26515 |
| Price |
$99.00 |
| Name |
TGFB2 Peptide - middle region (AAP45446) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TGFB2 |
| Alias symbols |
MGC116892, TGF-beta2 |
| Gene id |
7042 |
| Description of target |
This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Swissprot id |
P61812 |
| Protein accession num |
NP_003229 |
| Nucleotide accession num |
NM_003238 |
| Protein size |
414 amino acids |
| Molecular weight |
46kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT |
| Partner proteins |
APP,TGFBR3,APP,BMP2,CTGF,ENG,FMOD,LTBP3,PZP,TGFB1,TGFB2,TGFB3,TGFBR1,TGFBR2,TGFBR3,VASN,VTN,DAXX,DCN,PZP,TGFB1,TGFBR2,TGFBRAP1,VASN,VTN |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TGFB2 Antibody(ARP45446_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
