| Sku |
AAP44820 |
| Old sku |
AAPP12296 |
| Price |
$99.00 |
| Name |
ERP29 Peptide - N-terminal region (AAP44820) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ERP29 |
| Alias symbols |
C12orf8, ERp28, ERp31, PDI-DB, PDIA9 |
| Gene id |
10961 |
| Description of target |
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Swissprot id |
P30040 |
| Protein accession num |
NP_006808 |
| Nucleotide accession num |
NM_006817 |
| Protein size |
261 amino acids |
| Molecular weight |
26kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
| Partner proteins |
ERP29,HSPA5,UBQLN4 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ERP29 Antibody(ARP44820_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
