| Sku |
AAP44636 |
| Price |
$99.00 |
| Name |
AGPAT2 Peptide - C-terminal region (AAP44636) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
AGPAT2 |
| Alias symbols |
1-AGPAT2, BSCL, BSCL1, LPAAB, LPAAT-beta |
| Gene id |
10555 |
| Description of target |
AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. |
| Swissprot id |
O15120 |
| Protein accession num |
NP_006403 |
| Nucleotide accession num |
NM_006412 |
| Protein size |
278 amino acids |
| Molecular weight |
31kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
QVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALV |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-AGPAT2 Antibody (ARP44636_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
