SLCO1A2 Peptide - middle region (AAP43899)

Data Sheet
 
Sku AAP43899
Old sku AAPP11702
Price $99.00
Name SLCO1A2 Peptide - middle region (AAP43899)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SLCO1A2
Alias symbols OATP, OATP-A, OATP1A2, SLC21A3
Gene id 6579
Description of target SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.
Swissprot id P46721-2
Protein accession num AAD52694
Nucleotide accession num NM_021094
Protein size 579 amino acids
Molecular weight 64kDa
Species reactivity Human
Application IHC, WB
Peptide sequence VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK
Partner proteins PDZD3,PDZK1,SLC9A3R1,SLC9A3R2
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SLCO1A2 Antibody(ARP43899_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com