Sku |
AAP43899 |
Old sku |
AAPP11702 |
Price |
$99.00 |
Name |
SLCO1A2 Peptide - middle region (AAP43899) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SLCO1A2 |
Alias symbols |
OATP, OATP-A, OATP1A2, SLC21A3 |
Gene id |
6579 |
Description of target |
SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. |
Swissprot id |
P46721-2 |
Protein accession num |
AAD52694 |
Nucleotide accession num |
NM_021094 |
Protein size |
579 amino acids |
Molecular weight |
64kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK |
Partner proteins |
PDZD3,PDZK1,SLC9A3R1,SLC9A3R2 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SLCO1A2 Antibody(ARP43899_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |