| Sku |
AAP42380 |
| Price |
$99.00 |
| Name |
Grem1 Peptide - C-terminal region (AAP42380) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Grem1 |
| Alias symbols |
Cktsf1b1, Drm, ld |
| Gene id |
23892 |
| Description of target |
Grem1 is a cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as BMP a antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. It down-regulates the BMP4 signaling in a dose-dependent manner and acts as inhibitor of monocyte chemotaxis. |
| Swissprot id |
O70326 |
| Protein accession num |
NP_035954 |
| Nucleotide accession num |
NM_011824 |
| Protein size |
184 amino acids |
| Molecular weight |
21kDa |
| Species reactivity |
Mouse, Human |
| Application |
WB |
| Peptide sequence |
EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Grem1 Antibody (ARP42380_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
