SOCS1 Peptide - middle region (AAP42148)

Data Sheet
 
Sku AAP42148
Old sku AAPS11809
Price $99.00
Name SOCS1 Peptide - middle region (AAP42148)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SOCS1
Alias symbols CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP3
Gene id 8651
Description of target SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
Swissprot id O15524
Protein accession num NP_003736
Nucleotide accession num NM_003745
Protein size 211 amino acids
Molecular weight 23kDa
Species reactivity Human
Application WB
Peptide sequence RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
Partner proteins AXL,CSF1R,FLT3,FYN,GRB2,IGF1R,INSR,ITK,KIT,NCK1,PDGFRB,PIK3R2,TEK,VAV1,VAV2,AXL,COMMD1,CSF1,CSF1R,CXCR4,EGFR,FLT3,FYN,GHR,GRB2,IFNGR1,IGF1R,IL2RB,INSR,IRS1,IRS2,ITK,JAK1,JAK2,JAK3,KIT,MPL,NCK1,PDGFRB,PIK3R1,PIK3R2,PIM2,RELA,TCEB1,TCEB2,TEC,TEK,TIRAP,TRIM8
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SOCS1 Antibody(ARP42148_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com