Sku |
AAP42148 |
Old sku |
AAPS11809 |
Price |
$99.00 |
Name |
SOCS1 Peptide - middle region (AAP42148) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SOCS1 |
Alias symbols |
CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP3 |
Gene id |
8651 |
Description of target |
SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. |
Swissprot id |
O15524 |
Protein accession num |
NP_003736 |
Nucleotide accession num |
NM_003745 |
Protein size |
211 amino acids |
Molecular weight |
23kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Partner proteins |
AXL,CSF1R,FLT3,FYN,GRB2,IGF1R,INSR,ITK,KIT,NCK1,PDGFRB,PIK3R2,TEK,VAV1,VAV2,AXL,COMMD1,CSF1,CSF1R,CXCR4,EGFR,FLT3,FYN,GHR,GRB2,IFNGR1,IGF1R,IL2RB,INSR,IRS1,IRS2,ITK,JAK1,JAK2,JAK3,KIT,MPL,NCK1,PDGFRB,PIK3R1,PIK3R2,PIM2,RELA,TCEB1,TCEB2,TEC,TEK,TIRAP,TRIM8 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SOCS1 Antibody(ARP42148_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |