MMP3 Peptide - middle region (AAP42041)

Data Sheet
 
Sku AAP42041
Old sku AAPP24522
Price $99.00
Name MMP3 Peptide - middle region (AAP42041)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MMP3
Alias symbols CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1
Gene id 4314
Description of target MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.
Swissprot id P28862
Protein accession num NP_002413
Nucleotide accession num NM_002422
Protein size 477 amino acids
Molecular weight 43kDa
Species reactivity Human
Application IHC, WB
Peptide sequence SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
Partner proteins ACAN,BCAN,CCL13,CCL2,CCL7,CCL8,DCN,HAPLN1,IGFBP3,MMP3,PLG,SERPINE1,SPOCK1,SPOCK3,SPP1,TIMP1,TIMP3,TNFSF11,BCAN,SPOCK3,TIMP1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MMP3 Antibody(ARP42041_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com