Sku |
AAP42041 |
Old sku |
AAPP24522 |
Price |
$99.00 |
Name |
MMP3 Peptide - middle region (AAP42041) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
MMP3 |
Alias symbols |
CHDS6, MGC126102, MGC126103, MGC126104, MMP-3, SL-1, STMY, STMY1, STR1 |
Gene id |
4314 |
Description of target |
MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase. |
Swissprot id |
P28862 |
Protein accession num |
NP_002413 |
Nucleotide accession num |
NM_002422 |
Protein size |
477 amino acids |
Molecular weight |
43kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Partner proteins |
ACAN,BCAN,CCL13,CCL2,CCL7,CCL8,DCN,HAPLN1,IGFBP3,MMP3,PLG,SERPINE1,SPOCK1,SPOCK3,SPP1,TIMP1,TIMP3,TNFSF11,BCAN,SPOCK3,TIMP1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-MMP3 Antibody(ARP42041_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |