| Sku |
AAP41879 |
| Price |
$99.00 |
| Name |
KLK3 Peptide - middle region (AAP41879) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
KLK3 |
| Alias symbols |
APS, KLK2A1, PSA, hK3 |
| Gene id |
354 |
| Description of target |
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. |
| Swissprot id |
P07288 |
| Protein accession num |
NP_001639 |
| Nucleotide accession num |
NM_001648 |
| Protein size |
261 amino acids |
| Molecular weight |
26kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI |
| Partner proteins |
AR,POLR2A,CTNNB1,KAT5,RUVBL1,A2M,ALB,EPOR,FN1,IGFBP3,PLG,PTHLH,PZP,SEMG1,SEMG2,SERPINA1,SERPINA3,SERPINA5,SLPI,A2M,SERPINA1,SERPINA5 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-KLK3 Antibody (ARP41879_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
