Cox6a1 Peptide - C-terminal region (AAP41557)

Data Sheet
 
Sku AAP41557
Price $99.00
Name Cox6a1 Peptide - C-terminal region (AAP41557)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Cox6a1
Alias symbols VIaL
Gene id 12861
Description of target The function of this protein remains unknown.
Swissprot id Q9DCW5
Protein accession num NP_031774
Nucleotide accession num NM_007748
Protein size 112 amino acids
Molecular weight 12kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE
Partner proteins SNCA
Subunit 6A1, mitochondrial
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Cox6a1 Antibody (ARP41557_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com