Ctsd Peptide - C-terminal region (AAP41481)

Data Sheet
 
Sku AAP41481
Old sku AAPS09403
Price $99.00
Name Ctsd Peptide - C-terminal region (AAP41481)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Ctsd
Alias symbols CD, CatD
Gene id 13033
Description of target Ctsd is an acid protease active in intracellular protein breakdown.
Swissprot id P18242
Protein accession num NP_034113
Nucleotide accession num NM_009983
Protein size 410 amino acids
Molecular weight 45kDa
Species reactivity Mouse
Application WB
Peptide sequence KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Ctsd Antibody (ARP41481_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com