Sku |
AAP41388 |
Price |
99 |
Name |
SLC12A1 Peptide - N-terminal region (AAP41388) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SLC12A1 |
Alias symbols |
BSC1, NKCC2 |
Gene id |
6557 |
Description of target |
This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven. |
Swissprot id |
Q8IUN5 |
Protein accession num |
NP_000329.2 |
Nucleotide accession num |
NM_000338.2 |
Protein size |
430 amino acids |
Molecular weight |
47 kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti-SLC12A1 Antibody (ARP41388_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |