Sku |
AAP39819 |
Price |
99 |
Name |
BCL11B Antibody - N-terminal region (AAP39819) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
BCL11B |
Alias symbols |
ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha |
Gene id |
64919 |
Description of target |
This gene encodes a C2H2-type zinc finger protein and is closely related to BCL11A, a gene whose translocation may be associated with B-cell malignancies. Although the specific function of this gene has not been determined, the encoded protein is known to be a transcriptional repressor, and is regulated by the NURD nucleosome remodeling and histone deacetylase complex. Four alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Swissprot id |
Q9C0K0-2 |
Protein accession num |
NP_612808 |
Nucleotide accession num |
NM_138576.4 |
Protein size |
823 amino acids |
Molecular weight |
88 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGG |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- BCL11B Antibody (ARP39819_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |