PPARGC1A Peptide - N-terminal region (AAP39015)

Data Sheet
 
Sku AAP39015
Old sku AAPS03708
Price $99.00
Name PPARGC1A Peptide - N-terminal region (AAP39015)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PPARGC1A
Alias symbols LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Gene id 10891
Description of target The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.
Swissprot id Q9UBK2
Protein accession num NP_037393
Nucleotide accession num NM_013261
Protein size 798 amino acids
Molecular weight 91kDa
Species reactivity Human
Application WB
Peptide sequence MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Partner proteins NR1I3,ESR1,ESR2,ESRRA,ESRRG,HCFC1,HNF4A,MAPK14,MED1,MYBBP1A,NCL,NCOA1,NR1H4,NR1I2,NR1I3,NR3C1,NRF1,PPARA,PPARG,RXRA,SIRT1,THRB,USF2,CREBBP,EP300,ESR1,ESRRA,ESRRG,Esrrg,FBXW7,GSK3B,HCFC1,HNF4A,IQGAP1,LRPPRC,MED1,MED12,MED14,MED16,MED17,MED20,MED21,MYOD1,NC
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-PPARGC1A Antibody(ARP39015_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com