Sku |
AAP39015 |
Old sku |
AAPS03708 |
Price |
$99.00 |
Name |
PPARGC1A Peptide - N-terminal region (AAP39015) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
PPARGC1A |
Alias symbols |
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1 |
Gene id |
10891 |
Description of target |
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. |
Swissprot id |
Q9UBK2 |
Protein accession num |
NP_037393 |
Nucleotide accession num |
NM_013261 |
Protein size |
798 amino acids |
Molecular weight |
91kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Partner proteins |
NR1I3,ESR1,ESR2,ESRRA,ESRRG,HCFC1,HNF4A,MAPK14,MED1,MYBBP1A,NCL,NCOA1,NR1H4,NR1I2,NR1I3,NR3C1,NRF1,PPARA,PPARG,RXRA,SIRT1,THRB,USF2,CREBBP,EP300,ESR1,ESRRA,ESRRG,Esrrg,FBXW7,GSK3B,HCFC1,HNF4A,IQGAP1,LRPPRC,MED1,MED12,MED14,MED16,MED17,MED20,MED21,MYOD1,NC |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-PPARGC1A Antibody(ARP39015_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |