ZHX1 Peptide - N-terminal region (AAP38924)

Data Sheet
 
Sku AAP38924
Price $99.00
Name ZHX1 Peptide - N-terminal region (AAP38924)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ZHX1
Gene id 11244
Description of target The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 1 of this gene family. In addition to forming homodimers, this protein heterodimerizes with members 2 and 3 of the zinc fingers and homeoboxes family. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 8 open reading frame 76 (C8orf76) gene.
Swissprot id Q9UKY1
Protein accession num NP_009153
Nucleotide accession num NM_007222
Protein size 873 amino acids
Molecular weight 98kDa
Species reactivity Human
Application WB
Peptide sequence PPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPD
Partner proteins NFYA,AKR1C3,ATXN1,BARD1,BHLHE40,CHD3,CSNK2A1,DDX39B,DLST,DYNLL1,GNG11,HSPE1,IDH1,LAMA4,LYAR,MPHOSPH6,NACA,NFYA,PAFAH1B3,PEX14,PIAS4,PIGC,PNP,PRPF40A,PSMD11,SAT1,SERPINB9,TAL1,TALDO1,TARDBP,TERF1,TNFRSF10C,TOLLIP,TP53,UTP3,VIM,WDR33,ZHX1,ZHX2,ZHX3,AKR1C3,A
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ZHX1 Antibody (ARP38924_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com