Foxo4 Peptide - C-terminal region (AAP38710)

Data Sheet
 
Sku AAP38710
Price $99.00
Name Foxo4 Peptide - C-terminal region (AAP38710)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Foxo4
Alias symbols Afxh, MGC117660, Mllt7, afx
Gene id 54601
Description of target Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Swissprot id Q99MK2
Protein accession num NP_001005872
Nucleotide accession num NM_001005872
Protein size 505 amino acids
Molecular weight 54kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Foxo4 Antibody (ARP38710_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com