| Sku |
AAP38498 |
| Old sku |
AAPP10022 |
| Price |
$99.00 |
| Name |
NOTCH4 Peptide - C-terminal region (AAP38498) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NOTCH4 |
| Alias symbols |
FLJ16302, INT3, MGC74442, NOTCH3 |
| Gene id |
4855 |
| Description of target |
NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases. |
| Swissprot id |
Q99466 |
| Protein accession num |
NP_004548 |
| Nucleotide accession num |
NM_004557 |
| Protein size |
2003 amino acids |
| Molecular weight |
58kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE |
| Partner proteins |
DLL4,FBXW7,MAML1,MAML2,MAML3,NOTCH4,PSEN1,PSEN2,RBPJ,SMAD2,SMAD3,SMAD4,MAML1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NOTCH4 Antibody, made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
