| Sku |
AAP38484 |
| Old sku |
AAPP23193 |
| Price |
$99.00 |
| Name |
HOXC6 Peptide - C-terminal region (AAP38484) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
HOXC6 |
| Alias symbols |
CP25, HHO.C8, HOX3, HOX3C |
| Gene id |
3223 |
| Description of target |
This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. |
| Swissprot id |
P09630 |
| Protein accession num |
NP_710160 |
| Nucleotide accession num |
NM_153693 |
| Protein size |
153 amino acids |
| Molecular weight |
18kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
| Partner proteins |
HMGB1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-HOXC6 Antibody (ARP38484_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
