| Sku |
AAP38446 |
| Price |
$99.00 |
| Name |
MED7 Peptide - C-terminal region (AAP38446) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MED7 |
| Alias symbols |
CRSP33, CRSP9, MGC12284, ARC34 |
| Gene id |
9443 |
| Description of target |
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. |
| Swissprot id |
O43513 |
| Protein accession num |
NP_004261 |
| Nucleotide accession num |
NM_004270 |
| Protein size |
233 amino acids |
| Molecular weight |
27kDa |
| Species reactivity |
Human |
| Application |
WB, CHIP |
| Peptide sequence |
LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE |
| Partner proteins |
HGS,MED8,MED9,BARHL1,CDK8,CTDP1,ESR1,ESR2,FXR2,HGS,HNF4A,IKBKG,LZTR1,MED1,MED10,MED14,MED15,MED19,MED22,MED25,MED26,MED28,MED29,MED31,MED9,PARP1,PCBD2,PML,RBFOX2,RELA,RHOXF2,SREBF1,TRIM15,TRIM29,UBAC1,VDR,ZSCAN1 |
| Subunit |
7 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MED7 Antibody (ARP38446_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
