Klf4 Peptide - N-terminal region (AAP38429)

Data Sheet
 
Sku AAP38429
Old sku AAPP20618
Price $99.00
Name Klf4 Peptide - N-terminal region (AAP38429)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Klf4
Alias symbols EZF, Gklf, Zie
Gene id 16600
Description of target The function of Klf4 remains unknown.
Swissprot id Q60793
Protein accession num NP_034767
Nucleotide accession num NM_010637
Protein size 474 amino acids
Molecular weight 51kDa
Species reactivity Mouse
Application WB
Peptide sequence MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH
Partner proteins Apc,Pou5f1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Klf4 Antibody(ARP38429_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com