| Sku |
AAP37305 |
| Old sku |
AAPP09273 |
| Price |
$99.00 |
| Name |
Nrip2 Peptide - N-terminal region (AAP37305) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Nrip2 |
| Alias symbols |
AW491344, MGC144354, NIX1 |
| Gene id |
60345 |
| Description of target |
NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors. |
| Swissprot id |
Q9JHR9-2 |
| Protein accession num |
NP_068363 |
| Nucleotide accession num |
NM_021717 |
| Protein size |
229 amino acids |
| Molecular weight |
25kDa |
| Species reactivity |
Mouse |
| Application |
WB |
| Peptide sequence |
MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLP |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Nrip2 Antibody(ARP37305_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
