| Sku |
AAP37048 |
| Old sku |
AAPP09244 |
| Price |
$99.00 |
| Name |
Foxf1a Peptide - middle region (AAP37048) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Foxf1 |
| Alias symbols |
AI450827, FREAC1, Foxf1, Freac-1, HFH-8, Hfh8, Foxf1a |
| Gene id |
15227 |
| Description of target |
The function of this protein remains unknown. |
| Swissprot id |
Q61080 |
| Protein accession num |
NP_034556 |
| Nucleotide accession num |
NM_010426 |
| Protein size |
353 amino acids |
| Molecular weight |
38kDa |
| Species reactivity |
Mouse |
| Application |
IHC, WB |
| Peptide sequence |
GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Foxf1a Antibody(ARP37048_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
