| Sku |
AAP36847 |
| Old sku |
AAPY01690 |
| Price |
$99.00 |
| Name |
Elf3 Peptide - middle region (AAP36847) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Elf3 |
| Alias symbols |
ESE-1, ESX, jen |
| Gene id |
13710 |
| Description of target |
Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Elf3 acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter.Elf3 also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Elf3 represses KRT4 promoter activity.Elf3 is involved in mediating vascular inflammation. Elf3 may play an important role in epithelial cell differentiation and tumorigenesis. Elf3 may be a critical downstream effector of the ERBB2 signaling pathway. Elf3 may be associated with mammary gland development and involution. Elf3 plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development. |
| Swissprot id |
Q3UPW2 |
| Protein accession num |
NP_031947 |
| Nucleotide accession num |
NM_007921 |
| Protein size |
371 amino acids |
| Molecular weight |
42kDa |
| Species reactivity |
Mouse |
| Application |
WB |
| Peptide sequence |
TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Elf3 Antibody(ARP36847_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
