Sku |
AAP36843 |
Old sku |
AAPP09916 |
Price |
$99.00 |
Name |
Ehf Peptide - middle region (AAP36843) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Ehf |
Alias symbols |
9030625L19Rik, AU019492 |
Gene id |
13661 |
Description of target |
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containing the consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter. |
Swissprot id |
O70273 |
Protein accession num |
NP_031940 |
Nucleotide accession num |
NM_007914 |
Protein size |
300 amino acids |
Molecular weight |
35kDa |
Species reactivity |
Mouse |
Application |
IHC, WB |
Peptide sequence |
LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Ehf Antibody(ARP36843_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |