| Sku |
AAP36356 |
| Price |
$99.00 |
| Name |
DHX16 Peptide - N-terminal region (AAP36356) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
DHX16 |
| Alias symbols |
DBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2 |
| Gene id |
8449 |
| Description of target |
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
B4DZ28 |
| Protein accession num |
NP_001157711 |
| Nucleotide accession num |
NM_001164239 |
| Protein size |
981 amino acids |
| Molecular weight |
107kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA |
| Partner proteins |
COIL,MEGF10,SRRM1,SRRM2,TADA2A |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-DHX16 Antibody (ARP36356_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
