Sku |
AAP35960 |
Old sku |
AAPP07218 |
Price |
$99.00 |
Name |
MESP1 Peptide - C-terminal region (AAP35960) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
MESP1 |
Alias symbols |
MGC10676, bHLHc5 |
Gene id |
55897 |
Description of target |
MESP1 is a transcription factor. MESP1 plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. MESP1 defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways. |
Swissprot id |
Q9BRJ9 |
Protein accession num |
NP_061140 |
Nucleotide accession num |
NM_018670 |
Protein size |
268 amino acids |
Molecular weight |
28kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-MESP1 Antibody (ARP35960_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |