MESP1 Peptide - C-terminal region (AAP35960)

Data Sheet
 
Sku AAP35960
Old sku AAPP07218
Price $99.00
Name MESP1 Peptide - C-terminal region (AAP35960)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MESP1
Alias symbols MGC10676, bHLHc5
Gene id 55897
Description of target MESP1 is a transcription factor. MESP1 plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. MESP1 defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
Swissprot id Q9BRJ9
Protein accession num NP_061140
Nucleotide accession num NM_018670
Protein size 268 amino acids
Molecular weight 28kDa
Species reactivity Human
Application WB
Peptide sequence GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MESP1 Antibody (ARP35960_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com