Sku |
AAP34180 |
Old sku |
AAPP05442 |
Price |
$99.00 |
Name |
Pax8 Peptide - C-terminal region (AAP34180) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Pax8 |
Alias symbols |
Pax-8 |
Gene id |
18510 |
Description of target |
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development. |
Swissprot id |
Q00288 |
Protein accession num |
NP_035170 |
Nucleotide accession num |
NM_011040 |
Protein size |
457 amino acids |
Molecular weight |
49kDa |
Species reactivity |
Mouse |
Application |
WB |
Peptide sequence |
PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS |
Partner proteins |
Nkx2-1,Phf17 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Pax8 Antibody (ARP34180_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |