| Sku |
AAP34172 |
| Price |
99 |
| Name |
SMARCB1 Peptide - middle region (AAP34172) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SMARCB1 |
| Alias symbols |
RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144 |
| Gene id |
6598 |
| Description of target |
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene. |
| Swissprot id |
Q12824-2 |
| Protein accession num |
NP_001007469 |
| Nucleotide accession num |
NM_001007468.2 |
| Protein size |
376 amino acids |
| Molecular weight |
41 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: PLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQF |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- SMARCB1 Antibody (ARP34172_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
