| Sku |
AAP33518 |
| Price |
99 |
| Name |
ZNF24 Peptide - N-terminal region (AAP33518) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ZNF24 |
| Alias symbols |
ZNF24,KOX17, ZNF191, ZSCAN3, |
| Gene id |
7572 |
| Description of target |
ZNF24 is a transcription factor required for myelination of differentiated oligodendrocytes. It is required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), it is involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). It has transcription repressor activity in vitro. |
| Swissprot id |
P17028 |
| Protein size |
368 amino acids |
| Molecular weight |
40kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-ZNF24 Antibody (ARP33518_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
