| Sku |
AAP33176 |
| Price |
99 |
| Name |
TBX20 Peptide - N-terminal region (AAP33176) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TBX20 |
| Alias symbols |
TBX20, |
| Gene id |
57057 |
| Description of target |
This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
Q9UMR3 |
| Protein size |
447 amino acids |
| Molecular weight |
49kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: RANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDA |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TBX20 Antibody (ARP33176_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
